Question: What Is The Concept Of Drafting?

How do you use the word draft?

Draft in a Sentence 🔉Before I submit my final article, I need to edit my draft.

The blueprint draft has been sketched but the official copy isn’t finished.

There were so many spelling mistakes in the first draft, the whole letter had to be written.More items….

Why is it important to draft a document first?

First and foremost, writing a first draft is a very important stage in the writing process. It provides the writer with a chance to meld their thoughts together and to further develop their ideas. Because it is a preliminary stage in the writing process, however, many students fail to grasp its importance.

What is meant by draft age?

All men 18 years and older had to register with Selective Service. All men between the ages of 18 to 25 were eligible to be drafted for a service requirement of 21 months.

What is meant by drafting?

Drafting (writing), writing something that is likely to be amended. Technical drawing, the act and discipline of composing diagrams that communicates how something functions or is to be constructed. E.g.: Architectural drawing.

What is the opposite of draft?

What is the opposite of draft?cullrejectcuteliminaterebuffsnubspurnexcluderule out

What is Final Draft?

: a final version of something (such as a document) usually after a lot of editing and rewriting The final draft is due tomorrow.

What is another word for drafting?

What is another word for drafting?composingframingcraftingdesigningdevisingdrawingplanningproducingsketchingwriting10 more rows

What are the 7 steps of the writing process?

The writing process, according to the EEF’s ‘Improving Literacy In Key Stage 2’ guidance report, can be broken down into 7 stages: Planning, Drafting, Sharing, Evaluating,Revising, Editing and Publishing.

Which word best defines drafting?

Wiktionary. drafting(Noun) The act or process of producing a technical drawing, or draft. drafting(Noun) The art of producing technical drawings.

What are the kinds of drafting?

The major kinds of drafting are furniture drafting, architectural drafting, mechanical or machine drafting, electrical and electronics drafting, topographical drafting, airplane drafting, ship or naval drafting, structural drafting and sheet-metal drafting.

What is an example of a draft?

The definition of draft is something that is used for pulling, drawn from a cask or is in a rough form. An example of draft is a horse that pulls a beer truck. An example of draft is a beer on tap. An example of draft is a book without any corrections made.

How is drafting best used?

Drafting is best to develop your idea and organize your thoughts. … Consequently, fixing specific problems in sentences, words, grammar, spelling, usage, or mechanics when writing a first draft can be distracting and can hinder the development of important and interesting ideas.

What is the correct definition of a boat’s draft?

The draft or draught of a ship’s hull is the vertical distance between the waterline and the bottom of the hull (keel), with the thickness of the hull included; in the case of not being included the draft outline would be obtained. Draft determines the minimum depth of water a ship or boat can safely navigate.

What is the purpose of drafting?

During the drafting stage of writing, a student develops a more cohesive text and explores their topic, directed by purpose, audience, genre, and content. Drafting helps students expand upon, clarify, and modify their initial plans and ideas, and it helps them organize their content into a meaningful sequence or flow.